Protein Info for MPMX19_05955 in Azospirillum sp. SherDot2

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details PF00892: EamA" amino acids 20 to 153 (134 residues), 46.7 bits, see alignment E=1.9e-16 amino acids 162 to 288 (127 residues), 56.8 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_e03190)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>MPMX19_05955 Riboflavin transporter (Azospirillum sp. SherDot2)
MTVPPQSTPLTHKRVDDTPRGIASMLMSVLFFSLMNVLAKLLMDRFPVTEVMFFRSLFAL
IPVCLSIHLGTGFATTLRTRYPWGHMGRSLIGLTTMVAMFWSFHLLPLGDAIALNFAAPL
FLTALSVPLLSEKVGIHRWSAVLVGFAGVLIIVRPSGDVLNLGAIIALCGALTNALAMIA
IRQLSRTERPDTIVFYFTLLTTVLLGLSLPFSWVTPDPMDWLLLLVTGLFGGCGQLMLTR
AYSLAPAAVVAPLNYTSLLLAVIFGWFMWGEVPTATMAAGAAVVMASGLYILHRETRRRT
TVTKPLPAGDGD