Protein Info for MPMX19_05886 in Azospirillum sp. SherDot2

Annotation: Na(+)/H(+) antiporter NhaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 55 (24 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 320 to 344 (25 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 9 to 407 (399 residues), 178.5 bits, see alignment E=9.9e-57

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 45% identity to hoh:Hoch_4495)

Predicted SEED Role

"Na+/H+ antiporter NhaP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>MPMX19_05886 Na(+)/H(+) antiporter NhaP (Azospirillum sp. SherDot2)
MGPFHLSAILLTLAAIFGLINYKWLKLPNTISLFFQGLALALLVSGIDAAGSSLGVGDWL
RGLIDQISLPAILLDGILSLLLYTAAVNEDLCVLLKRKWTVLALATVSVLLFTGLMGLGL
HVLFPLVGIEVPLIWCLVLGAAVAPTDPVAVHGILGRLPVPDSLRSVISGESLFNDGAGV
VLFVTLLHLATGSEQDLTVGEAALDFLKEAVGGAALGFACGWIAYQAKRRVDESVVELTI
SLALVLGTYSLASRLGLSGPIAVVVAGLLIGSTTGRHVRSDESRRDLHVVWRMIDAVLNS
LLFLLVGLEATVVISWTGPVLFAAVLAVPLALAARMLSLTPALLMHMGRTDKSSALAVLT
WAGLRGGVAVALVLSLPASPYRDPILAVCYVAVAFSILVQGLTLEPIGRRLYGGRQDP