Protein Info for MPMX19_05875 in Azospirillum sp. SherDot2

Annotation: Catabolite control protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00356: LacI
  • amino acids 19 to 64 (46 residues), 57.4 bits, 1.9e-19
• PF00532: Peripla_BP_1
  • amino acids 75 to 343 (269 residues), 105.9 bits, E=5.6e-34
• PF13377: Peripla_BP_3
  • amino acids 190 to 349 (160 residues), 139.6 bits, E=2.2e-44

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 55% identity to bid:Bind_0624)

Predicted SEED Role

No annotation

Protein Sequence (366 amino acids)

>MPMX19_05875 Catabolite control protein A (Azospirillum sp. SherDot2)
MAGPRDREKPGGEKPGSVTLTEVAGHAGVSRSTVSLVLRGSPLVAAETRERVQAAMAALG
YIYNRGAANLRAARTQTVGLLVCELNNPFYAELTAGVDDVLDTEGFVAFIANTAEQPERQ
DRFLQRMREHNVDGVILCPAAGTDSGLLDRLDGWRLPCVQALRFVPDSLESGRGRDYAGV
DYQAGIETVIDHLVALGHRRIAFVGGTLDHSAYAGRHAGFTAAMRRHGLADDLVLRCPLT
RRSGAGIADDLLNRPQTPTAALCYNDVVALGLMLGLEARGLRAGRDLAVTGFDDVPEAAL
SRPALTTVATSARQIGQEAARLLLRRIADPQGPPERIILPSRLVVRQSCGSPGAAPSPSL
HHRDLS