Protein Info for MPMX19_05797 in Azospirillum sp. SherDot2

Annotation: Cyclic-di-GMP-binding biofilm dispersal mediator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00106: adh_short" amino acids 8 to 185 (178 residues), 142.6 bits, see alignment E=1.7e-45 PF01370: Epimerase" amino acids 9 to 173 (165 residues), 34.3 bits, see alignment E=2.7e-12 PF13561: adh_short_C2" amino acids 16 to 235 (220 residues), 159.1 bits, see alignment E=2.1e-50

Best Hits

Swiss-Prot: 63% identical to BDCA_ECOLI: Cyclic-di-GMP-binding biofilm dispersal mediator protein (bdcA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to azl:AZL_d01320)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>MPMX19_05797 Cyclic-di-GMP-binding biofilm dispersal mediator protein (Azospirillum sp. SherDot2)
MGEFTGRKILVLGGSRGIGKAIVRRFAKAGGTVAFTYAGSKDAAEALAAETGSEAIRTDS
ADRDALIATVADRGALDVLVVNAGTAILGDPLTFDPDAVDRMIDINVRAPYHAAVEAARR
MNDGGRIIVIGSVNGDRMPFAGGAAYALTKAAVQGMVRGLARDFGDRGITVNAIQPGPTH
SDMNPADGPMAPAMHSFMAIKRHIDADEVAELTAYVAGPHAGMITGSFQTIDGGFGA