Protein Info for MPMX19_05789 in Azospirillum sp. SherDot2

Annotation: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR01832: 2-deoxy-D-gluconate 3-dehydrogenase" amino acids 5 to 252 (248 residues), 409 bits, see alignment E=3.4e-127 PF00106: adh_short" amino acids 10 to 202 (193 residues), 182.6 bits, see alignment E=8.9e-58 PF08659: KR" amino acids 12 to 162 (151 residues), 24.4 bits, see alignment E=3.7e-09 PF13561: adh_short_C2" amino acids 16 to 249 (234 residues), 193.3 bits, see alignment E=7.6e-61

Best Hits

Swiss-Prot: 66% identical to KDUD_ECOLI: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Escherichia coli (strain K12)

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 73% identity to azl:AZL_d01440)

MetaCyc: 66% identical to putative 2-keto-3-deoxy-D-gluconate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]; 1.1.1.- [EC: 1.1.1.127]; RXN0-7101 [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>MPMX19_05789 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (Azospirillum sp. SherDot2)
MSISFDLTGKVALVTGANTGIGQGIALALAEAGADIAAVDVVSLDETKGLVEATGRKFLG
IHADLTSIAPVQGLVEETVAKLGGLDILVNNAGMIRRADAVDFSEADWDAVMNLNIKTVF
FLCQAFGRYAIGAGRKGKIINIASMLSFQGGIRVPSYTASKSGVAGITKLLACEWAGKGI
NVNAIAPGYVATNNTAALRADENRSAEILGRIPAGRWSLPSDIGGPAVFLASDAADYIHG
TILPVDGGWLAR