Protein Info for MPMX19_05774 in Azospirillum sp. SherDot2

Annotation: 1,2-phenylacetyl-CoA epoxidase, subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR02160: phenylacetate-CoA oxygenase/reductase, PaaK subunit" amino acids 6 to 357 (352 residues), 462.8 bits, see alignment E=3.1e-143 PF00970: FAD_binding_6" amino acids 11 to 106 (96 residues), 45.7 bits, see alignment E=1e-15 PF00175: NAD_binding_1" amino acids 121 to 228 (108 residues), 70.7 bits, see alignment E=2.5e-23 PF00111: Fer2" amino acids 275 to 347 (73 residues), 57.7 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K02613, phenylacetic acid degradation NADH oxidoreductase (inferred from 93% identity to azl:AZL_d01580)

MetaCyc: 52% identical to ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (Pseudomonas sp. Y2)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase/reductase, PaaK subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>MPMX19_05774 1,2-phenylacetyl-CoA epoxidase, subunit E (Azospirillum sp. SherDot2)
MTSPSFHPLTIRECRRETADTVSIAFDVPADLADRFRFVQGQYLTLKTRIGDEEVRRSYS
ICSGAGDGELRVAVKKVDGGLFSTHANQSLAPGAVLEVMTPMGRFYTPIDPNAARTYVAF
AAGSGITPVMSILKTVLAQEPKSRFVLVYGNRTVSSIIFREELEDLKNRYIGRLVIHHVL
SREPEEAGLLGGRIGAALVRELCAGPLKAEDIDAAFLCGPQPMVEEVRDALAACGTPAAN
IHVELFGTTTAARPAAKKAPTDSPTDAATIAVLQDGKRKEFTLAYDGESILEAAHRHGAD
LPYSCKSGVCCTCRAKVREGKVEMAENYSLEAWEIEAGYVLTCQSRPLTERVVIDFDAA