Protein Info for MPMX19_05734 in Azospirillum sp. SherDot2

Annotation: Tol-Pal system protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 85 to 107 (23 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 75 to 284 (210 residues), 303 bits, see alignment E=6.3e-95 PF01618: MotA_ExbB" amino acids 170 to 264 (95 residues), 101.8 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 53% identical to EXBB_PSEPU: Biopolymer transport protein ExbB (exbB) from Pseudomonas putida

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 58% identity to mci:Mesci_1109)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MPMX19_05734 Tol-Pal system protein TolQ (Azospirillum sp. SherDot2)
MPTSFRHRPVLAAVLAGAGVLMAGAVQAQEAAAPAAVPGVAQGVAQGAAQGMSQGVAQGV
PDAAAALASLPHDLSPWGMFVTASPVVQAVMVGLALASVVTWTIAIAKTAEVTSAKRKAR
AALEMLEEARSLSQAAERVGFSQGTAGALVRAVLAETHMSADAPSRDGLMDRAASRLERI
EAAAGRRMARGTGILATIGSTGPFIGLFGTVWGIMTSFIGISKAQTTNLAVVAPGIAEAL
LATAIGLVAAIPAVVVYNACSRAIGGHKAQLTDASAAVLRLLSRDIDRHALPRPHAVPGH
GVQGHAAQAHGNSRAAE