Protein Info for MPMX19_05702 in Azospirillum sp. SherDot2

Annotation: Ethanolamine ammonia-lyase light chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF05985: EutC" amino acids 10 to 243 (234 residues), 301.7 bits, see alignment E=1.7e-94

Best Hits

KEGG orthology group: K03736, ethanolamine ammonia-lyase small subunit [EC: 4.3.1.7] (inferred from 88% identity to azl:AZL_d02210)

Predicted SEED Role

"Ethanolamine ammonia-lyase light chain (EC 4.3.1.7)" in subsystem Ethanolamine utilization (EC 4.3.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.7

Use Curated BLAST to search for 4.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>MPMX19_05702 Ethanolamine ammonia-lyase light chain (Azospirillum sp. SherDot2)
MTDTPKDNQKDPWARFRSATRARIALGRSGDALPTKALLEFQLAHARARDAVHSAVDFDR
LAADLSPLETIRVHSAAPDRPTYLRRPDLGRRLDPASAAGLTAGEWAAGEWDLVFVIADG
LSAAAVQVNAVPLIRACTARLGHLRIGPVVLAEQARVALGDEVASAMGARLVALLVGERP
GLSAAESLGVYLTWDPKPGRADSERNCISNIHSGGLSIQTAADKLCWLATEAARLKLTGV
ALKEDAPSLAGPDNEKNQLTDRS