Protein Info for MPMX19_05649 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF01555: N6_N4_Mtase" amino acids 24 to 245 (222 residues), 224.4 bits, see alignment E=1.8e-70 PF18755: RAMA" amino acids 261 to 358 (98 residues), 56.5 bits, see alignment E=2.5e-19

Best Hits

Swiss-Prot: 64% identical to MTB1_OCHA4: Modification methylase BabI (ccrM) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K13581, modification methylase [EC: 2.1.1.72] (inferred from 97% identity to azl:AZL_d02330)

Predicted SEED Role

"Modification methylase"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>MPMX19_05649 hypothetical protein (Azospirillum sp. SherDot2)
MLPENRILVGDCIALMNDLPPASVDLIFADPPYNLQLGGELLRPNHTRVAGVDDEWDKFD
DFEAYDRFTQDWMAAARRILKPEGSLWVIGSYHNIFRVGATLQNLGFWILNDIVWRKTNP
MPNFRGTRFANAHETMIWAARDKDARYRFNYDAMKSLNEDLQMRSDWLLPICNGGERLRD
EDGKKTHPTQKPESLLYRVILSSSRPGDVVLDPFFGTGTTGAVAKRLGRKWIGLERDDTY
VKAAQARIDAVEEAPEAAILDTPPKRAAPRIPFGWVVERGLLRPGSTLFDHRRRVAARVR
ADGTLIGSGPRGDHRGSIHQVGAAMAGLPACNGWTFWHYEEGEDLRPIDVLRERIRSEMH