Protein Info for MPMX19_05634 in Azospirillum sp. SherDot2

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 5 to 142 (138 residues), 213.6 bits, E=1.8e-67
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 13 to 352 (340 residues), 412.5 bits, E=9.8e-128
• PF00903: Glyoxalase
  • amino acids 160 to 270 (111 residues), 51.4 bits, E=2.1e-17

Best Hits

Swiss-Prot: 62% identical to HPPD_PSEAE: 4-hydroxyphenylpyruvate dioxygenase (hpd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 94% identity to azl:AZL_d02430)

MetaCyc: 58% identical to 4-hydroxyphenylpyruvate dioxygenase subunit (Pseudomonas sp. P.J. 874)
4-hydroxyphenylpyruvate dioxygenase. [EC: 1.13.11.27]

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Protein Sequence (357 amino acids)

>MPMX19_05634 4-hydroxyphenylpyruvate dioxygenase (Azospirillum sp. SherDot2)
MADMWDNPMKTDGFEFIEFTAPDTVALGRLFEQLGFTAIARHRSKDVTLYRQGDVNFIVN
AEPSGFPRNFAAQHGPSICAIAFRVGDAAFAYRRALDLGAWGVETRVGAMELNIPAIKGI
GDSLIYLVDRYADRGSIYEVDFVPLTGVDQHPQGAGLTYIDHLTHNVHTGRMEEWAEFYT
RLFGFREIRYFDIEGKLTGLRSKAMTSPCGKIRIPINESADNKSQIVEYLRDYRGEGIQH
VALGTNDIVRTVETMRGMGTPFQDTPDTYYERVDTRVPGHNQDLKRLQANRILLDGAPTE
GQGLLLQIFTQTVIGPIFFEIIQRIGNEGFGEGNFKALFESIELDQIRRGVLSEDAA