Protein Info for MPMX19_05622 in Azospirillum sp. SherDot2

Annotation: Sensor histidine kinase RegB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details PF02518: HATPase_c" amino acids 333 to 433 (101 residues), 47.8 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 94% identity to azl:AZL_d02580)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>MPMX19_05622 Sensor histidine kinase RegB (Azospirillum sp. SherDot2)
MVTLASALTGPVPASPAPPHWAQPDGRITLRTLILIRWVAVLGQLAAVTFVNLGLGFPLP
LGPVLAAISASALLNVVAMTQRGGRLRLADRDAALYLSYDMLQLTLLLYLTGGLSNPFAI
LLLAPMTVGAAILSRYSTVLLTGLNLICLTALALWHFPLPWEEPVRSMAPLYAFGVWLSL
TVSSVFIAGYVFRVAAEARRFADALAASQVALAREQRLGALGALAAAAAHELGSPLGTIA
VVAKELARDLPPDSPYGEDVELLQSQVMRCREILADLARKPEADGGDPFERLPLTALIEA
AAAPHRLGHIDFAVEPHPVGEAEEPFLRRSPEIIHGIGNFIQNAHQFARHKVTVAAAWDG
RGVTITVMDDGPGFPSHLLGRIGEPYLSVRGERSGPKGQAGGGHMGLGIFIAQTLLEKTG
ATVRYTNNPPDGTPPADQAAGGHSNQGGTGARISVRWKTINAKK