Protein Info for MPMX19_05616 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF06181: Urate_ox_N" amino acids 4 to 296 (293 residues), 446.1 bits, see alignment E=3.3e-138

Best Hits

KEGG orthology group: None (inferred from 93% identity to azl:AZL_d02670)

Predicted SEED Role

"FIG137887: membrane protein related to purine degradation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>MPMX19_05616 hypothetical protein (Azospirillum sp. SherDot2)
MEPILWEWINALARWLHVITAIAWIGSSFYFIHLDASLRRRAGAPAGTAGDAWQIHGGGF
YHMTKYMVAPPQLPEDLTWFKWESYATWLSGFFLMCVLYYRGADLFLIDQDVLALSHWQA
VAISVGALVAGWVAYDLMCKSPLGRNDGALAVAGFVMLVATAWGMTKIFSGRGAMLQVGA
LMATMMACNVFMLIIPNQRKTVAAMLRGETPDPSLGKKAKQRSLHNNYLTLPVVFLMLSN
HYPLVSSTRYNWVMVALVLVVGTAIRHFFNSRHAGKPTPWWTWGVAVAGMLGCIWLSTMG
PATADTAAAAAVKVGFAQVEEIVATRCSMCHAAQPVWEGIATPPRGVVLEGDGIRRHAEQ
IRLQAGYSSAMPPANITGITPQERAVLAAWAGDIK