Protein Info for MPMX19_05582 in Azospirillum sp. SherDot2

Annotation: Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF00158: Sigma54_activat" amino acids 194 to 360 (167 residues), 231.4 bits, see alignment E=1.3e-72 PF14532: Sigma54_activ_2" amino acids 194 to 365 (172 residues), 70.7 bits, see alignment E=4e-23 PF01078: Mg_chelatase" amino acids 211 to 316 (106 residues), 20.5 bits, see alignment E=7.1e-08 PF07728: AAA_5" amino acids 217 to 335 (119 residues), 31.9 bits, see alignment E=3e-11 PF02954: HTH_8" amino acids 465 to 500 (36 residues), 44.4 bits, see alignment 2.7e-15

Best Hits

KEGG orthology group: None (inferred from 54% identity to pmy:Pmen_4358)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>MPMX19_05582 Anaerobic nitric oxide reductase transcription regulator NorR (Azospirillum sp. SherDot2)
MLTSDIVGKLRCNAADPKAGIARGLDTGTTKIGPVWEGDVGDTVDFEALRQRAVHSLFEH
LESMCVGAVAVDHAGRIAWMDEKYKALLGVPGDPRGRQVEDVIPNSQLRRVIDSGQPQPL
DIMEFDDRSFVVTRMPLFGTDGSIIGAIGFVLFDRAEYLRPLVRKYEKMQEELARTQQEL
AHERRAKYSFSQFLGASESIREIKRLGRRAAQMDSTVLLLGETGTGKELLAQAIHSASPR
ASKPFVGVNVAAIPETLLEAEFFGVAPGAFTGADRRHRDGKFQLANGGTLFLDEIGDMPL
PVQAKLLRVLQEREIEPLGSNKVVRVDVRIIAATSRDLHALVREKQFRADLYYRLNVVPI
TLPPLRDRPEDIESIADRILEQLAIQQGTPPRELLESAVQVLRDYDWPGNVRELYNTLER
VVALTDAPILTAPYIRSVLPGQHPAGASALPLAAGARPLQEVLHAAERHAIAAALEEANG
VKARAAKLLGISRASLYERMVTLGLGATQ