Protein Info for MPMX19_05525 in Azospirillum sp. SherDot2

Annotation: HTH-type transcriptional regulator VirS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 100 to 118 (19 residues), see Phobius details PF12625: Arabinose_bd" amino acids 43 to 226 (184 residues), 156.4 bits, see alignment E=1.4e-49 PF12833: HTH_18" amino acids 275 to 351 (77 residues), 64.2 bits, see alignment E=1.7e-21 PF00165: HTH_AraC" amino acids 317 to 349 (33 residues), 27.2 bits, see alignment 5.1e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_d00690)

Predicted SEED Role

"AraC family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>MPMX19_05525 HTH-type transcriptional regulator VirS (Azospirillum sp. SherDot2)
MTPHRPTLGQTAGQLGGSRTGTVQHNILAAAACGVSDFIAAQGGCPDQVFHRAGVEERAL
CQPTLALDLRAYVAMMEVAAAETGNDNFGLMFGRQFQPEMLGLIGSIALAAPTLGAALDH
LARLFPFHQQATETRFVREGELLRLEYRILDGCIVERRQDAELTMGMFANVVRACLGPAW
MPEEVHFEHPKPEGWRQHEALFDAPAHFGQRTNAILLRDRQLDRRMPGGDMARLTGLCGT
LIDIARDTGTPPLLDRVKAEVRARLPEGPTYVEDIADRLGIARWTLQRRLADEGLSFSDL
VEGVRRDLAAVYIRQRHVPVADIGALLGYSEVSAFSRAFRRWFGMSPAKMRGA