Protein Info for MPMX19_05512 in Azospirillum sp. SherDot2

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 200 (186 residues), 123.7 bits, see alignment E=3.3e-40

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_d00800)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines, peptides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>MPMX19_05512 Homoserine/homoserine lactone efflux protein (Azospirillum sp. SherDot2)
MSADLWLAFAAASAIMLMIPGPTVLIVVSYALGHGRKSAMATVAGVALGDFTAMTASMLG
LGVLLSTSAALFTLLKWAGAAYLLYLGIKLWRAPVKGAEAVADDSDVRPWRMMLHTYAVT
ALNPKSIVFFVAFLPQFLDTGRPLAGQMVVMEATFLVLATLNAAGYALLASAARRAVRTP
SVQRAVNRVGGSLLMGAGLLTVAWKRTA