Protein Info for MPMX19_05504 in Azospirillum sp. SherDot2

Annotation: DNA polymerase IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF00817: IMS" amino acids 26 to 173 (148 residues), 151.9 bits, see alignment E=1.3e-48 PF11799: IMS_C" amino acids 259 to 362 (104 residues), 91.1 bits, see alignment E=6.3e-30

Best Hits

Swiss-Prot: 54% identical to DPO41_RHIME: DNA polymerase IV 1 (dinB1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 96% identity to azl:AZL_d01040)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MPMX19_05504 DNA polymerase IV (Azospirillum sp. SherDot2)
MTRCPKCGSRRLFRHAELHSLPIGHIDCDSFYATVEKRDRPELASRPVIVGGDDHRGVVA
ACCYVARISGVRSAMTIREALDRCPDATIIRPNIAKYKEVGHRAREIMEAFTPLVEPISI
DEAYLDLTGVEDRLSISPAQALVEIVRRFERELRITASIGLSYNKLLAKIASDLDKPRGF
SALGRAEAAAFLAPKRVTILWGVGPALERKLFTDGITRVGDLQDRDEHWLVKRYGAMGRV
LYSYARGEDSRRVHPESPSKSISSEETFDWDVTTLPALMQELRPLADKVARRLEREGLLG
RSVVLKLKTKDFQQLTRSRRVEPTRSAEAILAAGVALLEREVDGRAFRLIGIGCTDLTHP
ETAPDPELDLFG