Protein Info for MPMX19_05424 in Azospirillum sp. SherDot2

Annotation: Nitrogenase iron protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 328 to 351 (24 residues), see Phobius details PF13614: AAA_31" amino acids 18 to 190 (173 residues), 149.3 bits, see alignment E=3.9e-47 PF10609: ParA" amino acids 18 to 182 (165 residues), 48 bits, see alignment E=3.9e-16 PF09140: MipZ" amino acids 19 to 161 (143 residues), 32.9 bits, see alignment E=1.5e-11 PF01656: CbiA" amino acids 20 to 240 (221 residues), 77.5 bits, see alignment E=3e-25 PF00142: Fer4_NifH" amino acids 20 to 86 (67 residues), 37.9 bits, see alignment E=5.3e-13 PF02374: ArsA_ATPase" amino acids 25 to 63 (39 residues), 28.2 bits, see alignment 3.9e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_d04770)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>MPMX19_05424 Nitrogenase iron protein (Azospirillum sp. SherDot2)
MTSHEDVFDTPETRQPTILSVYNQKGGVGKTTTSVNLALALAALGKSVVLIDFDPQSSAT
SNFLLRDKAKVGINDLLRKETFVEDAITPTAFDGLSMIVGARKLYSLEHALDSRGGSQRG
LRKALHFSRNPPDYVVIDCPPALGHLAAGALAASDRLIVPVFPGRYALDGLRRTLQVVEH
IQNGLNPSLTLAGILMLSITNDEVGRESLTQLRNEFPEQMFRTAFPYDVDVVKATYRRMP
AAIFTPEARTTSRFAALAWEIVHGRGTAPDESQLKPALERIRSWHEATDTSYSARRASSI
DEGDEPGGGGGNGARQAERAQSSGRGGMGLGLLGLVIGLVGGFALGAAVGQPILGRLLGL
GG