Protein Info for MPMX19_05410 in Azospirillum sp. SherDot2

Annotation: Dipeptide transport system permease protein DppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 302 to 329 (28 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 116 (116 residues), 31.2 bits, see alignment E=2.3e-11 PF00528: BPD_transp_1" amino acids 129 to 334 (206 residues), 102.7 bits, see alignment E=2.1e-33

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 95% identity to azl:AZL_d04920)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>MPMX19_05410 Dipeptide transport system permease protein DppB (Azospirillum sp. SherDot2)
MLRFILHRLLVMVPTLFVVSMLIFTVINLPPGDYLSNQIAELRATGQEAGLAKAEFLRHE
YALDRPLAEQYLIWIGVWPGPNGFHGLLQGDLGWSFEFNKPVAAVVGETLWFTVILNLAA
VLFVYLVSFPLGALAAIRANSWVDYLAAAVGYIGLATPNFLLALILLYYGQKWLGLPIGG
LVDAQYEDQPLSWAKAGSVLEHLIIPTIVIGLSGTAAMVRRLRANLLDELGKPYVVTAKA
KGVPPLRRLTRYPLRMALNPFVSDIGSLLPSLVSGSVLISVVLSLPTIGPALLEALRAQD
IFLSGFILMFISLLVLVGMLVSDIALALLDPRIRLGKARKAQS