Protein Info for MPMX19_05409 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 60 to 81 (22 residues), see Phobius details amino acids 158 to 173 (16 residues), see Phobius details amino acids 190 to 218 (29 residues), see Phobius details amino acids 242 to 271 (30 residues), see Phobius details amino acids 313 to 339 (27 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF12911: OppC_N" amino acids 47 to 98 (52 residues), 37.6 bits, see alignment 1.6e-13 PF00528: BPD_transp_1" amino acids 208 to 395 (188 residues), 107.6 bits, see alignment E=6.8e-35

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 95% identity to azl:AZL_d04930)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>MPMX19_05409 hypothetical protein (Azospirillum sp. SherDot2)
MKGEGMKAPVTGGGTGGSWEHYVDDRPYPDPAAADAPATRFDANASTGRLMLRRFLRHRL
AVLGALFLGLSYLSLPFVDFLAPYGANERDVEHLYAPPQGVHLFHEGQLIGPFVYPTTGR
PDLKDYRWRYETDESRPMPLQFLCPGAPYRFLGLVESRVRLVCAPPGASLHLLGTDRLGR
DMLSRLAIGAQLSLTVGLLGIAVSFAIGITLGGMAGYFGGWIDAGVQRLSEILKSLPELP
LWLALSAAVPAQWSPVTVFLCISVILGLLDWPSLARAVRSRFLALREEDFVMAAELMGAS
PARIIRRHLLPNFASHLLASATLSIPAMILGETALSFLGLGLRPPATSWGVMLNDAQNLM
AVETYPWVSLPMLPVILVVLSFNFFGDGLRDALDPYHGD