Protein Info for MPMX19_05389 in Azospirillum sp. SherDot2

Annotation: Pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF00224: PK" amino acids 28 to 345 (318 residues), 367 bits, see alignment E=8.4e-114 TIGR01064: pyruvate kinase" amino acids 28 to 491 (464 residues), 507.5 bits, see alignment E=1.6e-156 PF02887: PK_C" amino acids 378 to 491 (114 residues), 107.9 bits, see alignment E=3.3e-35

Best Hits

Swiss-Prot: 66% identical to KPYK1_AGRVI: Pyruvate kinase (ttuE) from Agrobacterium vitis

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 96% identity to azl:AZL_d05100)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.40

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>MPMX19_05389 Pyruvate kinase (Azospirillum sp. SherDot2)
MVAAPAAHRTAQPKEDGPRGRNHMRRHRRAKIVATVGPASNSPEMLKTLFLAGVDTFRLN
FSHGTHDDHAKVHRAIRELEAEVGRPIGILQDLQGPKIRVGTIRDGKIAVSTGEQIRFVL
QGTDGDKRSIPLPHPEIFAAIMPGHHLLIDDGRVRVEVTELGDDWIEAKVVVGGIISNRK
GVNLPGTVLDLSPLTSKDRTDLAFGLELGVDWVAMSFVQKPGDILEGRGLIGDRAGIMAK
IEKPQALEKIDDIIRLSDAVMVARGDLGVEIPHEDVPGRQKELVRACRLAVKPVIVATQM
LDSMVSAPTPTRAEASDVATAIYDGADAVMLSAESASGQYPVEAVTMMDRIIRSTEQHKL
YRSLIQATHPGEEHTPPHAVAAAAADLADTLHSSAIVAFTSSGTTAARIARKRPEVPILA
ITPDTAVSRRLCLLWGAHSVLSDDIRTYEEMVDRAIAIGRSEELAGKTGTLVVVAGIPFA
QAGTTNNLRVIHMDGKA