Protein Info for MPMX19_05364 in Azospirillum sp. SherDot2

Annotation: Acetate CoA-transferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02428: 3-oxoacid CoA-transferase, B subunit
  • amino acids 4 to 205 (202 residues), 292.1 bits, E=9.5e-92
• PF01144: CoA_trans
  • amino acids 7 to 199 (193 residues), 140.5 bits, E=2.7e-45

Best Hits

Swiss-Prot: 60% identical to ATOA_ECOLI: Acetate CoA-transferase subunit beta (atoA) from Escherichia coli (strain K12)

KEGG orthology group: K01029, 3-oxoacid CoA-transferase subunit B [EC: 2.8.3.5] (inferred from 98% identity to azl:AZL_d00140)

MetaCyc: 60% identical to acetyl-CoA:acetoacetyl-CoA transferase subunit beta (Escherichia coli K-12 substr. MG1655)
Butyrate--acetoacetate CoA-transferase. [EC: 2.8.3.9]

Predicted SEED Role

"Butyrate-acetoacetate CoA-transferase subunit B (EC 2.8.3.9)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism (EC 2.8.3.9)

MetaCyc Pathways

• ketolysis (3/3 steps found)
• acetoacetate degradation (to acetyl CoA) (2/2 steps found)
• pyruvate fermentation to acetone (4/5 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
• L-lysine fermentation to acetate and butanoate (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of L-lysine degradation (13/43 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.9

Use Curated BLAST to search for 2.8.3.5 or 2.8.3.9

Protein Sequence (217 amino acids)

>MPMX19_05364 Acetate CoA-transferase subunit beta (Azospirillum sp. SherDot2)
MDEKTLIAKRVALELMDGDLVNLGIGLPTLVARYVPPGRHVFFQSENGIVGMSGPITGAE
NHDLTDAGGSPISALPGAASFDSAFSFGLIRGGHLDVTVLGGLQVDREGRLANWMVPGKM
VPGMGGAMDLVTGARRVIVAMQHSAKGEAKIVERCALPLTSVRRVDLVVTDLAVIEPTDA
GLVLKETAPGVTVEQVIANTGCELIIAPDLRSMPIEG