Protein Info for MPMX19_05300 in Azospirillum sp. SherDot2

Annotation: Signal transduction histidine-protein kinase AtoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 TIGR00229: PAS domain S-box protein" amino acids 56 to 174 (119 residues), 30.2 bits, see alignment E=2.2e-11 PF00989: PAS" amino acids 61 to 167 (107 residues), 38.8 bits, see alignment E=2.5e-13 PF08448: PAS_4" amino acids 65 to 172 (108 residues), 52.8 bits, see alignment E=1.3e-17 PF13426: PAS_9" amino acids 69 to 167 (99 residues), 37.4 bits, see alignment E=7.9e-13 PF00512: HisKA" amino acids 200 to 242 (43 residues), 26.9 bits, see alignment 1.2e-09 PF02518: HATPase_c" amino acids 335 to 442 (108 residues), 88.7 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 90% identity to azl:AZL_a10670)

Predicted SEED Role

"Signal transduction histidine kinase HoxJ (hydrogenase regulation)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>MPMX19_05300 Signal transduction histidine-protein kinase AtoS (Azospirillum sp. SherDot2)
MTAPLSQPFSIPGITSDADAESAWIDVIRKMDETYANLVTQQVELERKNAELEEAQAFIA
SVLGSMTDVLIACDRDGRIEQTNPAAERALGCAGRDLTGRPLRDFLDPAFHPAFARLCSA
ALQREEVSDVELSLRGPTGPFPVAVNSTVRYDQRGHAIGMVLVGRPIGELRRAYRDLAAA
HEGLKQTQQQLVHSEKMASLGRLVAGVAHELNNPISFVYGNAHAMRRYVDRMTAYLDRVH
DGAAAAELAGLRKDLRIDRARADAAATLDGMLEGTERVRDIVAELRRFSSEQKHASERFD
LTGLLRSAVTWVAKAQMPDLTVVFDLPDTLDIAGHPGHLHQVAMNLVQNAIDAMAGAAVK
RLELHGREKAGTVIVTFRDTGHGIPEAILARLFDPFFTTKPVGKGTGLGLSISYQLVHDH
GGALSAANHPDGGAQFTLTLPAAGQREGAGR