Protein Info for MPMX19_05279 in Azospirillum sp. SherDot2

Annotation: Copper-containing nitrite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02376: nitrite reductase, copper-containing
  • amino acids 41 to 343 (303 residues), 341.5 bits, E=2.7e-106
• PF07732: Cu-oxidase_3
  • amino acids 72 to 183 (112 residues), 50.6 bits, E=2e-17
• PF07731: Cu-oxidase_2
  • amino acids 86 to 182 (97 residues), 27.3 bits, E=2.7e-10
  • amino acids 228 to 330 (103 residues), 20.9 bits, E=2.6e-08

Best Hits

KEGG orthology group: K00368, nitrite reductase (NO-forming) [EC: 1.7.2.1] (inferred from 96% identity to azl:AZL_c02030)

Predicted SEED Role

"Copper-containing nitrite reductase (EC 1.7.2.1)" in subsystem Denitrification (EC 1.7.2.1)

MetaCyc Pathways

• nitrite-dependent anaerobic methane oxidation (2/3 steps found)
• nitrate reduction I (denitrification) (3/5 steps found)
• ammonia oxidation II (anaerobic) (1/3 steps found)
• nitrifier denitrification (3/6 steps found)
• nitrate reduction VII (denitrification) (2/5 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.2.1

Protein Sequence (355 amino acids)

>MPMX19_05279 Copper-containing nitrite reductase (Azospirillum sp. SherDot2)
MKTKLSLVTVSAAALMILSGIGAASAADTLYADPKVKQPTVSVVQDPASVPAPEKAGKRA
PKTHKVSLMTTEVESKLDDGTTYTYWTFNNTVPGPMVRVRVGDTVDVSISNAPESTMNHS
VDFHAATGFLGGGQITQVEPGQTKAFSFKALTPGVYVYHCATPMVAHHISKGMYGLIVVE
PEAGLAPVDHEFYVMQQEIYATKAKNLANAEDDYDGLVNERPSYLVFNGTVGALTKDKPL
KAKVGETVRLFFGVGGPNLTSSFHVIGEIFDKVYNLGGLESEPAKGIQTVTVAPGGATMV
EFKVDYPGKYALVDHALSRATKGLIGILEVEGKPDDSIIHDKTGDSRKQLGEMQH