Protein Info for MPMX19_05268 in Azospirillum sp. SherDot2

Annotation: Tryptophan 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF03301: Trp_dioxygenase" amino acids 17 to 207 (191 residues), 151.6 bits, see alignment E=1.8e-48 amino acids 210 to 283 (74 residues), 86.2 bits, see alignment E=1.5e-28 TIGR03036: tryptophan 2,3-dioxygenase" amino acids 21 to 282 (262 residues), 432.6 bits, see alignment E=2.7e-134

Best Hits

Swiss-Prot: 75% identical to T23O_BRADU: Tryptophan 2,3-dioxygenase (kynA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 95% identity to azl:AZL_c02120)

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>MPMX19_05268 Tryptophan 2,3-dioxygenase (Azospirillum sp. SherDot2)
MSGQDTKKPYDPAAEGAEMAFDGRMSYGDYLQLDRILGAQTPRSTAHDEMLFIVQHQTSE
LWMRLAIYEIRAAREAIREDRLSPAFKMLTRVARIFEQLNSAWDVLRTMTPSEYTRFRDD
LGQSSGFQSYQYREIEFLLGNRNPAMLRPHAHRPDIHALLEQELSRPSLYDEALRLLARN
GIPVPADVLERDVSQTHQPHDGVTEAWRIVYQSPEAHWPLYELAEKLVDFEDYFRRWRFN
HVTTVERVIGFKRGTGGTGGVSYLRNMLAVELFPELWRVRTVL