Protein Info for MPMX19_05264 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF02810: SEC-C" amino acids 4 to 18 (15 residues), 25.8 bits, see alignment (E = 7.6e-10) amino acids 139 to 157 (19 residues), 36.8 bits, see alignment (E = 2.8e-13) PF17775: UPF0225" amino acids 27 to 123 (97 residues), 95.9 bits, see alignment E=2.2e-31

Best Hits

Swiss-Prot: 43% identical to Y1492_PROMH: UPF0225 protein PMI1492 (PMI1492) from Proteus mirabilis (strain HI4320)

KEGG orthology group: None (inferred from 85% identity to azl:AZL_c02160)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>MPMX19_05264 hypothetical protein (Azospirillum sp. SherDot2)
MSVCPCGSGLAFDRCCGPILAGDPAPSAEALMRSRYTAFVRRDIDHIERSCVPETRATFS
RADVERVADECDWGPLTVMKAEETGDDGTVEFFLTFHRDGEEWPLHERSRFRRVDGRWFY
VDSVLNPKDQPRRVVKVGRNDPCPCGSGKKHKACCGR