Protein Info for MPMX19_05247 in Azospirillum sp. SherDot2

Annotation: Molybdenum cofactor guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF01128: IspD" amino acids 343 to 470 (128 residues), 40.4 bits, see alignment E=3e-14 PF12804: NTP_transf_3" amino acids 345 to 508 (164 residues), 139.7 bits, see alignment E=9.7e-45

Best Hits

KEGG orthology group: K07141, (no description) (inferred from 91% identity to azl:AZL_c02320)

Predicted SEED Role

"Uncharacterized MobA-related protein" in subsystem CO Dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>MPMX19_05247 Molybdenum cofactor guanylyltransferase (Azospirillum sp. SherDot2)
MFFGPLPLSDAEGAILAHSLRLGSIAFKKGRRLSADDLKALGEAGIAEVIAAKLSDTDIG
EDAAATRIAAAVAGGTVQVAAAFTGRVNLFAEAHGLLRLAPSRIDAINEIDESVTIATLP
DFAPVEPGQMLATVKIIPFAAPADAVERAERIATDGPPPLAVLPYRPLSVALIQTRLPGV
KDSVLDKTVAVTRERVEAIGGTLIHDSCCAHDEAALAAQIAGAPVADLLLIAGASAITDR
RDVLPAAIERAGGVVEHFGMPVDPGNLLLLARRDGKPVLGLPGCARSPKLNGFDWVLQRI
AAGIPPSRSEVMRMGVGGLLAEIPTRPLPRAGASPETPRAPRVTALVLAAGRSSRMGPTN
KLLAEVNGAPLVARAVDAALASQAAAVIVVTGHQGESVARALADRPVTFVHNPAFAEGLS
SSLRAGLAAVPSESDAVVVCLGDMPRVASAVIDRLIAAYSPLEGRAICIPTTHGKQGNPV
LWDRAFFTEMAALSGDAGAKRLIGQHADRLCEVPVDDAGILYDVDTPDLLARFTEAAGSG
PVSAPDPANAAS