Protein Info for MPMX19_05176 in Azospirillum sp. SherDot2

Annotation: 4-hydroxy-3-prenylphenylpyruvate oxygenase/4-hydroxy-3-prenylbenzoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00596: Aldolase_II" amino acids 32 to 212 (181 residues), 162.3 bits, see alignment E=6.1e-52

Best Hits

Swiss-Prot: 48% identical to CLOR_STRRC: 4-hydroxy-3-prenylphenylpyruvate oxygenase/4-hydroxy-3-prenylbenzoate synthase (cloR) from Streptomyces roseochromogenus subsp. oscitans

KEGG orthology group: None (inferred from 95% identity to azl:AZL_b02520)

MetaCyc: 47% identical to 3-dimethylallyl-4-hydroxyphenylpyruvate oxygenase (Actinoalloteichus caeruleus)
RXN-14670 [EC: 1.13.12.23]; RXN-14671 [EC: 1.13.12.23, 1.13.11.83]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.83 or 1.13.12.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>MPMX19_05176 4-hydroxy-3-prenylphenylpyruvate oxygenase/4-hydroxy-3-prenylbenzoate synthase (Azospirillum sp. SherDot2)
MTHIQPRPRKFWPPVDPVSYTSVEEERQHRKQRLAATFRLFGRYGFDQGLAGHVTARDPE
HPDRFWINPLGQHFRSIRVSDLHLVDGDGTILHGDRAINQAGFTIHSAIHRARPEVVAAA
HTHSTYGKAWSALGLPLAPLSQDSAAFYEDQVIFDPYSGVVLTEGEGRRLVEALGDRKLA
ILKNHGLLTVGPTVEAAAWWFISADNAAHTQLLAEAAGRPQPIDHDTALLTRSQVGTHQG
GAYNFHPLWDWIVAAEPDLLD