Protein Info for MPMX19_05152 in Azospirillum sp. SherDot2

Annotation: Phosphonoacetaldehyde hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01422: phosphonoacetaldehyde hydrolase
  • amino acids 13 to 259 (247 residues), 335.5 bits, E=1.7e-104
• PF00702: Hydrolase
  • amino acids 14 to 205 (192 residues), 54.2 bits, E=3.8e-18
• PF13419: HAD_2
  • amino acids 93 to 211 (119 residues), 32.6 bits, E=1.3e-11

Best Hits

Swiss-Prot: 48% identical to PHNX_DESVM: Phosphonoacetaldehyde hydrolase (phnX) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K05306, phosphonoacetaldehyde hydrolase [EC: 3.11.1.1] (inferred from 93% identity to azl:AZL_a10480)

Predicted SEED Role

"Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)" in subsystem Phosphonate metabolism (EC 3.11.1.1)

MetaCyc Pathways

• 2-aminoethylphosphonate degradation I (3/3 steps found)
• (1R)-(2-amino-1-hydroxyethyl)phosphonate degradation (1/2 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.1

Protein Sequence (276 amino acids)

>MPMX19_05152 Phosphonoacetaldehyde hydrolase (Azospirillum sp. SherDot2)
MSFVYSRRYTGPLQAVILDWAGTTVDHGCLAPAGAFMEAFRRSGVSITLDQARGPMGMAK
WHHIQAITRMGPVAEAWTAVHGAAPTDADVDRLYETFLPLQVEVVAQHSDLIPGAAETVA
AMRARGLKIGSTTGYPRPVMDVVQRVAAAQGYAPDITVCAGETPAGRPGPAMALRCVVEL
SISPVEACVKIGDTVVDVEEGLNAGMWTIAVADTGNEVGLPLANWQALAPDRRDALHAAA
SDRLARAGAHYVVRSLAEALPLLDAIEARLARGEKP