Protein Info for MPMX19_05119 in Azospirillum sp. SherDot2

Annotation: Glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 17 to 498 (482 residues), 595.3 bits, E=4.4e-183
• PF00479: G6PD_N
  • amino acids 19 to 197 (179 residues), 195.4 bits, E=1.4e-61
• PF02781: G6PD_C
  • amino acids 199 to 497 (299 residues), 416.5 bits, E=5.3e-129

Best Hits

Swiss-Prot: 62% identical to G6PD_RHIME: Glucose-6-phosphate 1-dehydrogenase (zwf) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 96% identity to azl:AZL_a09910)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• heterolactic fermentation (15/18 steps found)
• pentose phosphate pathway (7/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• cytosolic NADPH production (yeast) (4/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• pentose phosphate pathway (oxidative branch) I (2/3 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (506 amino acids)

>MPMX19_05119 Glucose-6-phosphate 1-dehydrogenase (Azospirillum sp. SherDot2)
MHSRSTGAAPALPPFDYTVFGGTGDLALRKLLPALYLRDKAGQVAEGSRIIGVSRSPLAP
SDYRAKAEEAIREHVPADERDTALVARFLERLDYVPVDATSDNGWDELAERLNNPPSRSN
DAVRIFYLATSPSLFGPVSDQLRAFGLATPESRVVLEKPIGRDLASAQEINDRVGAVFTE
QQIYRIDHYLGKETVQNLLALRFGNSLFEPLWNADHIDHVQITVAETVGVEERGGYYDQS
GALRDMVQNHLLQLVCLVGMECPISLAQESVRDEKLKVLRSLKAIGADEVGGCTVRGQYR
AGAVAGGAVPGYLDEPGIPPGSGTETFVALKLEIDNWRWAGVPFYLRSGKRLPAKMSEIV
IQFRPIRHSIFPQGAGELQANRLIVRLQPDESIRLHLMTKEPGPGGMRLRPAALNLSFAQ
TFGGRFPDAYERLLMDVVRGNSTLFMRRDEVEAAWQWAEPIIDGWMSRHEMPKPYIAGTW
GPSQSIALIERDGRTWHDDEIPSAAF