Protein Info for MPMX19_05113 in Azospirillum sp. SherDot2

Annotation: Coenzyme PQQ synthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR02108: coenzyme PQQ biosynthesis protein B" amino acids 2 to 310 (309 residues), 385 bits, see alignment E=1.1e-119 PF00753: Lactamase_B" amino acids 39 to 140 (102 residues), 24.4 bits, see alignment E=2.6e-09 PF12706: Lactamase_B_2" amino acids 50 to 277 (228 residues), 118.4 bits, see alignment E=3.2e-38

Best Hits

Swiss-Prot: 53% identical to PQQB_GLUDA: Coenzyme PQQ synthesis protein B (pqqB) from Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)

KEGG orthology group: K06136, pyrroloquinoline quinone biosynthesis protein B (inferred from 92% identity to azl:AZL_a09970)

Predicted SEED Role

"Coenzyme PQQ synthesis protein B" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>MPMX19_05113 Coenzyme PQQ synthesis protein B (Azospirillum sp. SherDot2)
MKILVLGSAAGGGFPQWNCACEGCRRARSGDPAAKPRTQSSLAVTADGERWLLLNVSPDL
GAQLLANPQLHPRNGLRGNPIGAALLTNADIDHVAGLLTLRESHPFAVYATPRVHGVLAG
NSVFNVLNPELVARRPMALGAPFQPAGADGRPLGLEVEAFAVPGKVALYLEDASAGPGFG
SVAEDTVALRIRPSDGSSDGFFYIPGCAGMPGWLADRLHGAPLVLFDGTTWTDDEMIRSG
TGVKTAARMGHMPMSGPAGSMAAFTPLSVARKFYIHINNTNPALLEDSPERAEAEAAGWR
IAHDGLELTL