Protein Info for MPMX19_05110 in Azospirillum sp. SherDot2

Annotation: PqqA peptide cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 17 to 370 (354 residues), 543.2 bits, see alignment E=2.6e-167 PF04055: Radical_SAM" amino acids 24 to 181 (158 residues), 84.4 bits, see alignment E=1.6e-27 PF13353: Fer4_12" amino acids 28 to 95 (68 residues), 23.4 bits, see alignment E=1e-08 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 253 to 343 (91 residues), 33.4 bits, see alignment E=4.9e-12 PF13186: SPASM" amino acids 254 to 316 (63 residues), 31.8 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 60% identical to PQQE_XANOR: PqqA peptide cyclase (pqqE) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 92% identity to azl:AZL_a10000)

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MPMX19_05110 PqqA peptide cyclase (Azospirillum sp. SherDot2)
MSCALPAFAASPAAEPAPPFAVLMELTHRCPLRCPYCSNPVALESASAELDTATWKRVLD
EAADAGALQVHFSGGEPCVRKDLEELVAHATEIGLYSNLITSAVLLDQSRLERLQRAGLQ
HVQISLQDAEAVGADRVGGFKGGHAKKLEVARAVVRQGMALTINAVLHRHNIDRVNDVID
LAMDLGAGRIEIANVQYYGWALANRAALMPSREQLLAMDAAVRGRLPELAGRIVVDYVVP
DYYARRPKSCMGGWARRFMNVTPRGRVLPCHAAETIPGMTFETVHDRSLSDIWRDGPAFA
RYRGTDWMPEPCQSCDHKEEDWGGCRCQALALAGSADATDPVCELSPAHAEVAVLRDRDA
AALGTEWTYRGL