Protein Info for MPMX19_05097 in Azospirillum sp. SherDot2

Annotation: L-cystine transport system permease protein YecS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 108 (97 residues), 99 bits, see alignment E=9.1e-33 PF00528: BPD_transp_1" amino acids 32 to 214 (183 residues), 70.5 bits, see alignment E=7.7e-24

Best Hits

Swiss-Prot: 32% identical to ARTQ_BACSU: Arginine transport system permease protein ArtQ (artQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 94% identity to azl:AZL_a10160)

Predicted SEED Role

"Cystine ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>MPMX19_05097 L-cystine transport system permease protein YecS (Azospirillum sp. SherDot2)
MLDLSLLVQYGPALLRGFGVTILCWGAGCLIGMVLGFALMLLRQLPVKPLRWIIRAYIEV
IRGTPFLIQLFLLYSGGPAIGLRLEATTAGILGLGIYGSAYFAEIFRAGYQAVPKGQVEA
ALSLGMSYGSILRRVIVPAMLVSTIPAIVNMMAILTKETVVLSIITVPELMYEMQTMAAE
TFATFETILGMALFYWLLVEVVSRLGRRLEARVTRFLTHASPQGSSSETATARA