Protein Info for MPMX19_05093 in Azospirillum sp. SherDot2

Annotation: Biotin transport ATP-binding protein BioM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 18 to 161 (144 residues), 100.5 bits, E=1.3e-32
• PF13304: AAA_21
  • amino acids 122 to 190 (69 residues), 31.5 bits, E=1.9e-11

Best Hits

Swiss-Prot: 64% identical to Y2469_DEIRA: Putative ABC transporter ATP-binding protein DR_2469 (DR_2469) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 92% identity to azl:AZL_c03350)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Protein Sequence (224 amino acids)

>MPMX19_05093 Biotin transport ATP-binding protein BioM (Azospirillum sp. SherDot2)
MIELRSVTHAYGDRPVLHDLSLRLAERRIAILGGNGSGKSTLARLLNGLIVPAAGTVTVD
GLDTRSDGRAVRQRVGFVFQNPDTQIVYPTVEEDLAFGLKARKLPKDEIARRVAGALERY
NLDRYRHQPAHQMSGGEKQLLAIAGVLVLEPAYVIFDEPTTLLDLRNRRKVIDLLRGLPQ
TVVVVTHDLDMVKDFDRALVLEDGRVVVDGPPTETVPAYIERLD