Protein Info for MPMX19_05086 in Azospirillum sp. SherDot2

Annotation: Formate-dependent phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01142: phosphoribosylglycinamide formyltransferase 2
  • amino acids 5 to 386 (382 residues), 569.1 bits, E=2.1e-175
• PF02222: ATP-grasp
  • amino acids 114 to 285 (172 residues), 183.9 bits, E=4e-58
• PF02786: CPSase_L_D2
  • amino acids 117 to 274 (158 residues), 27.5 bits, E=4.5e-10
• PF07478: Dala_Dala_lig_C
  • amino acids 130 to 275 (146 residues), 34.7 bits, E=2.6e-12
• PF21244: PurT_C
  • amino acids 312 to 384 (73 residues), 83.5 bits, E=1.2e-27

Best Hits

Swiss-Prot: 68% identical to PURT_ERYLH: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 95% identity to azl:AZL_c01530)

MetaCyc: 56% identical to phosphoribosylglycinamide formyltransferase monomer (Methanocaldococcus jannaschii)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• One carbon pool by folate
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 6.3.1.21

Protein Sequence (389 amino acids)

>MPMX19_05086 Formate-dependent phosphoribosylglycinamide formyltransferase (Azospirillum sp. SherDot2)
MFTARILLLGSGELGKEFVIAAKRLGCEVIACDSYANAPAMQVADRAEVFSMLDADALRA
AIAKHRPDYIVPEVEAIRTEVLHEFEDAGTIVVPSARAATMTMNRDRIREVAATELGLRT
SRYRYAESLEEVRAGAEHTGFPCVVKPVMSSSGKGQSTVQDAAGLEGAWDYAVANMRGDR
RKVIVEEFVPFEYEITLLTVRTRDGILYCEPIGHRQERGDYQESWQPVAMPQAMLDDAKA
MAARVVDNLGGYGIFGVEFFVTADEVIFSELSPRPHDTGMVTLLSQNLSEFELHARAILG
LPIPNILCHAPSASAVILADREAENFRIEGLADALRLGSTEQEVDIRLFGKPTTRKNRRM
GVALATGTDTDDARARAKQAADKVAIRYL