Protein Info for MPMX19_05078 in Azospirillum sp. SherDot2

Annotation: Protein-methionine-sulfoxide reductase catalytic subunit MsrP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 100 to 253 (154 residues), 121.8 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 64% identical to MSRP_AZOOP: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: K07147, (no description) (inferred from 92% identity to azl:AZL_c01460)

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>MPMX19_05078 Protein-methionine-sulfoxide reductase catalytic subunit MsrP (Azospirillum sp. SherDot2)
MLFKFPTASQAREDEVTPRELFLSRRSLIAGGAAAMALGSLPVWSGSALAGPFQAAATIK
PADPKFDPTTPMKSATTYNNFYEFGTGKSDPAENAGTLKTRPWEIAIGGEVGKPMTIGIE
DLLKVPMEERVYRLRCVEGWSMVIPWVGFPLAELLKRVEPTGNAKYVAFQTLNDPKQMPG
LRSWVLDWPYTEGLRLDEAMHPLTMLAVGMYGEVLPNQNGAPIRLVVPWKYGFKSIKSIV
KISLVKDQPATAWNKSQPREYGFYSNVNPDVDHPRWSQATERRVGEFSRRKTLPFNGYGE
EVASLYAGMDLKANY