Protein Info for MPMX19_05064 in Azospirillum sp. SherDot2

Annotation: Exodeoxyribonuclease 7 small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 TIGR01280: exodeoxyribonuclease VII, small subunit" amino acids 23 to 76 (54 residues), 71.3 bits, see alignment E=2.7e-24 PF02609: Exonuc_VII_S" amino acids 24 to 74 (51 residues), 64.7 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 61% identical to EX7S_GLUOX: Exodeoxyribonuclease 7 small subunit (xseB) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 93% identity to azl:AZL_c00970)

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>MPMX19_05064 Exodeoxyribonuclease 7 small subunit (Azospirillum sp. SherDot2)
MVLPDMPPSAASVPIPPDIAALSFEDALAELERIVRQLEEGRGKLDDAISSYERGTALKR
HCEMKLREAQAKIDRITVSADGSLGTEPARID