Protein Info for MPMX19_04993 in Azospirillum sp. SherDot2

Annotation: Gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00106: adh_short" amino acids 20 to 209 (190 residues), 170.2 bits, see alignment E=5.8e-54 PF08659: KR" amino acids 22 to 197 (176 residues), 60.1 bits, see alignment E=4.1e-20 PF13561: adh_short_C2" amino acids 29 to 261 (233 residues), 210.6 bits, see alignment E=4e-66

Best Hits

Swiss-Prot: 42% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 90% identity to azl:AZL_c04980)

MetaCyc: 42% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.69

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>MPMX19_04993 Gluconate 5-dehydrogenase (Azospirillum sp. SherDot2)
MTATTPSNLAYLSNFSLAGQVALVTGSGRGLGLEIARALAGSGAHVLLNGRDAATLEDRV
AEIEAAGGSASALAFDVSDRAAVRDAFARIDREHGRLDVFVQNVGQRNRKPLAELTDDEI
VTLLDVDLASSLILAREAARLMLPRGSGRLIAVTSVAGQIARANDSVYAAAKAGLNGMVR
ALAAEYGAQGLTSNAIAPGFFATETNAAIAGDPERGAYFANRTPLGRWGRPEEIAGAAVF
LASAAASYVNGHVLVVDGGATILM