Protein Info for MPMX19_04954 in Azospirillum sp. SherDot2

Annotation: Putative hydro-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF07286: D-Glu_cyclase" amino acids 111 to 253 (143 residues), 222.3 bits, see alignment E=1.1e-70

Best Hits

Swiss-Prot: 69% identical to Y2233_BORPD: Putative hydro-lyase Bpet2233 (Bpet2233) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: None (inferred from 69% identity to bpt:Bpet2233)

Predicted SEED Role

"hypothetical protein possibly connected to lactam utilization and allophanate hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>MPMX19_04954 Putative hydro-lyase (Azospirillum sp. SherDot2)
MTTTPLSAAAERLRIRSGANSGQTAGLAPGHVQANLAILPADWAGDFLRFCQANPRPCPL
LAVSEVGDPRLPTLGHDIDIRTDVPRYRVYRDGVLSAEPTDIGDLWQDDFVAFLIGCSFS
FEEALLADGLPVRHIAMNRNVPMYETSIPCTPAGRFGGTMVVSMRPMVPKDAIRAIQITS
RFPSVHGAPVHFGDPAAIGIRNIAQPEHGEAVPIEPGEVPVFWACGVTPQVAIRNARPPI
AISHSPGAMLITDLLNTHLSVL