Protein Info for MPMX19_04950 in Azospirillum sp. SherDot2

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 222 to 254 (33 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 277 (268 residues), 138.4 bits, see alignment E=1.3e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 53% identity to sti:Sthe_2885)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>MPMX19_04950 High-affinity branched-chain amino acid transport system permease protein LivH (Azospirillum sp. SherDot2)
MTADILFQVLVSGLLIGLIYALVAVGLTLIFGVMDIVNFAHGEFLMLGMYASFWAFALFA
IDPIVALPLTALLLFAVGVIVYQTVIRRILKAPMLSQIFATFGLMILLRGLAQFFWKPDH
RLIPHSLVSGNVAFGPVQFGLPQFVAALGAVGVTGALWMFLHRTRLGTALEATAIDREAA
TLMGIDGQKMFALAWGIGAACAGLAGGLIATFFPIFPEVGSNFILIAFVVVVLGGFGSVT
GAFLAGIIVGLIEVLGGFLVGPEYKTAIVLSLLLIVLLVRPRGLLGKA