Protein Info for MPMX19_04915 in Azospirillum sp. SherDot2

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF00892: EamA" amino acids 11 to 143 (133 residues), 60.2 bits, see alignment E=1.2e-20 amino acids 152 to 281 (130 residues), 34.8 bits, see alignment E=8.4e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_c00340)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MPMX19_04915 Riboflavin transporter (Azospirillum sp. SherDot2)
MTAAPATDTRRGILMMLGGMTLFTLNDALGKWLVADHPVAMLLAVRSLFGLAVLAPMIWR
EGIAAVFAVNRLPLHILRVLLMTVDVACFYWAVGYLPLADVMTIYMSAPLIVTALSVLVL
RESVGWRRWVAVLVGFVGVVIVLNPTGRFDLWPSLVALIGAFIFSSGVISTRVLRSASSL
TLVGNQMVGGLLIGGVTLPWTWEAPGWLGFILLGLLGVTALAGHAMMNRSLQLSPAAVVV
PFQYVSILWAVLLDLAVWGTAPTARMGVGAALIIGSGLFIVYREQRLKRGVAAEGVAEVP