Protein Info for MPMX19_04884 in Azospirillum sp. SherDot2

Annotation: 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 52 to 72 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details PF00892: EamA" amino acids 31 to 121 (91 residues), 29.9 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: None (inferred from 47% identity to gdj:Gdia_0754)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>MPMX19_04884 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (Azospirillum sp. SherDot2)
MPIAVVGLILLSVTLSAIAQISLKIGMSSPAVSTALAGGGAGRIALSVVATPHILTGLAC
YGLGMVVWLAVLAKVDVSMAYPFVGLGFLVTLALGMLLLGETISMTRLIGTLLVVLGVVL
TAQS