Protein Info for MPMX19_04745 in Azospirillum sp. SherDot2

Annotation: HTH-type transcriptional regulator CdhR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 20 to 33 (14 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 46 to 182 (137 residues), 36.9 bits, see alignment E=5.1e-13 PF12833: HTH_18" amino acids 244 to 322 (79 residues), 77.3 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: None (inferred from 95% identity to azl:AZL_c01870)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>MPMX19_04745 HTH-type transcriptional regulator CdhR (Azospirillum sp. SherDot2)
MKCNEQQSGVSQADTIGFLLVPDFSMIAFTAAVEPLRLANHISGKELYRWVLLSPTGGVQ
RASNGIGICVDHAIADCPPLSTVMVCSGIGGHWYEDRAMFSWMRRSAAQGIAFGALCTAS
HILARAGLLNGYRCTIHWENMAGFAETFPEIEATGELFTIDRNRFTCAGGTAATDMMLHL
IAARHGEKLAMDIAEQLLHTKIRAGSIRQQEELQANPVLDHEDLHAAVAVMQANIEEPLD
LLTLAAELGQSRRNLERLFRKYMNCSPAKYYLGLRMKRARQLLCQTRMSVMEVSISCGFI
SATHFSKCYRDHFGIAPRSDRQSQRHSPLAAAHEFAGLT