Protein Info for MPMX19_04703 in Azospirillum sp. SherDot2

Annotation: L-serine dehydratase TdcG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03315: SDH_beta
  • amino acids 4 to 156 (153 residues), 175.6 bits, E=9.1e-56
• TIGR00720: L-serine ammonia-lyase
  • amino acids 4 to 457 (454 residues), 594.1 bits, E=9.2e-183
• PF03313: SDH_alpha
  • amino acids 191 to 454 (264 residues), 284.8 bits, E=7.5e-89

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 94% identity to azl:AZL_c01660)

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• glycine betaine degradation III (6/7 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• glycine betaine degradation I (6/8 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Protein Sequence (460 amino acids)

>MPMX19_04703 L-serine dehydratase TdcG (Azospirillum sp. SherDot2)
MFLSVFDVFKIGIGPSSSHTMGPMTAAVRFLDMLRASADAAPAAITVRLHGSLAFTGKGH
ATDRAVLLGLLDYRPDNLNVDEAEERIAELWRTRRLHPVGLPALDFDPETDLVFDFGPPL
SGHANGLVFQALDPAGKVTLSEIFYSIGGGFVVTAAEREAPPTVFASESAGWPYPFHNAA
AMLRMARESGASIAEMKRANEIVVRSPAEVDEKLGAVWAAMNGCIERGLSLDGQLPGSLK
VKRRAKAIHQQLLRERGANSSLPHVASDWLAIYAMAVNEENAAGGRVVTAPTNGAAGVVP
AVLRYYLDHCAGAEPAKVADFLLTAAAIGGLIKHNASISGAEAGCQGEVGSAAAMAAAGL
CAVLGGTPEQVENAAEIALEHHLGMTCDPVAGLVQVPCIERNAIGATKAVAAASLALRGD
GQHFMPLDNCIQAMRQTGEEMSTKFKETSLGGLAVNLPEC