Protein Info for MPMX19_04653 in Azospirillum sp. SherDot2

Annotation: Fumarate reductase flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details PF12831: FAD_oxidored" amino acids 23 to 196 (174 residues), 32.6 bits, see alignment E=2.1e-11 PF01266: DAO" amino acids 23 to 215 (193 residues), 43.7 bits, see alignment E=1e-14 PF03486: HI0933_like" amino acids 23 to 52 (30 residues), 24.5 bits, see alignment (E = 3.8e-09) PF00890: FAD_binding_2" amino acids 23 to 439 (417 residues), 190.3 bits, see alignment E=2.5e-59

Best Hits

KEGG orthology group: K00244, fumarate reductase flavoprotein subunit [EC: 1.3.99.1] (inferred from 72% identity to azc:AZC_2105)

Predicted SEED Role

"Fumarate reductase flavoprotein subunit (EC 1.3.99.1)" in subsystem Succinate dehydrogenase (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>MPMX19_04653 Fumarate reductase flavoprotein subunit (Azospirillum sp. SherDot2)
MSGGHPSRILPADGVEFEFTVPVVVIGGGAAGMVAALAAHERGAGVLVLERDALPQGSTA
LSAGLIPAPGTRWQLNAGIEDSPERFATDILAKAKGEPDPAEVDRVAQAVGPALEWLADR
YGLPFSVVDNFSYPGHSARRMHGLPSRSGAELIDRLRGAVETAGIDVLCEAHVTALHADG
ARIRGVEITRPDGSVERVGCGALILACNGYGGNRALVGQHVPELADALYFGHPGNQGDAL
LWGEALGAATRHLSGHQGHGSVAHPAGILVTWATITEGGVQVNAEGRRFSNEAQGYSEQA
AVVLRQPDGIAWTVFDERIAGIARQFEDFRQAEAMGAVLIADTPAELARLMKIDADALAA
TLTDIDRLKAEGWTDGFGRDFAGSAPLVPPYRAVRVTGALFHTQGGLVVDDEARVLDGQG
TPLPNLYAAGGAACGVSGSKASGYLSGNGLLTAVALGRIAGMAAAGAVSEETNQ