Protein Info for MPMX19_04646 in Azospirillum sp. SherDot2

Annotation: Monoacylglycerol lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF12146: Hydrolase_4" amino acids 34 to 270 (237 residues), 188.5 bits, see alignment E=1.9e-59 PF00561: Abhydrolase_1" amino acids 38 to 266 (229 residues), 47.6 bits, see alignment E=2.6e-16 PF12697: Abhydrolase_6" amino acids 39 to 267 (229 residues), 38.7 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: None (inferred from 90% identity to azl:AZL_c02800)

Predicted SEED Role

"Lysophospholipase (EC 3.1.1.5)" in subsystem Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>MPMX19_04646 Monoacylglycerol lipase (Azospirillum sp. SherDot2)
MGMAVVQPQLNDKVLIAADGFELPMRSWLPADGKVRAAVVALHGYNDYSNAFDGAGRDFA
TAGIATYAYDQRGFGATRERGVWAGTPTLVSDARTAVEMVHKRHPGVPVYLMGESMGGAV
VLSAMTGSNPPKVDGTVLVAPAVWGRQAMGFFPRAALWITYNLVPGMVVHPPKDLDIHPS
DNIEMLRALGRDPLVIKGSRVDALEGLTDLMGSALDACQHLQTPSLVLYGAHEEVLPPRP
VERALKDFESGGRHVVAVYPDGYHMLLRDLKGKLVVNDVIAWIANPKVPLASGADRAPRA
LLAAK