Protein Info for MPMX19_04641 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 TIGR00229: PAS domain S-box protein" amino acids 4 to 129 (126 residues), 76 bits, see alignment E=2.8e-25 amino acids 133 to 251 (119 residues), 58.2 bits, see alignment E=8.9e-20 PF00989: PAS" amino acids 7 to 120 (114 residues), 35 bits, see alignment E=4.6e-12 amino acids 133 to 242 (110 residues), 53.3 bits, see alignment E=9.2e-18 PF13188: PAS_8" amino acids 7 to 61 (55 residues), 27.9 bits, see alignment 6e-10 PF08448: PAS_4" amino acids 13 to 125 (113 residues), 30.5 bits, see alignment E=1.3e-10 amino acids 137 to 246 (110 residues), 35.6 bits, see alignment E=3.5e-12 PF13426: PAS_9" amino acids 19 to 122 (104 residues), 36.4 bits, see alignment E=1.8e-12 amino acids 142 to 244 (103 residues), 35.8 bits, see alignment E=2.9e-12 PF08447: PAS_3" amino acids 30 to 117 (88 residues), 38.2 bits, see alignment E=5.1e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 254 to 415 (162 residues), 131.8 bits, see alignment E=1.9e-42 PF00990: GGDEF" amino acids 256 to 410 (155 residues), 158.4 bits, see alignment E=4.8e-50 PF00563: EAL" amino acids 433 to 668 (236 residues), 249.5 bits, see alignment E=1e-77

Best Hits

KEGG orthology group: None (inferred from 96% identity to azl:AZL_c02770)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (685 amino acids)

>MPMX19_04641 hypothetical protein (Azospirillum sp. SherDot2)
MSHDTEEQYRSIFENAVEGIYQTTVDGRYLRVNPALADIYGYASPEDLIANLTDIACQLY
VDPGKREAFADLMARQDRVLSFEARVFRRDGSIIWISESARCVRDAAGRIRYYEGTVQDI
TERKQHEEKIRLLATVFDSVADGILIVDPELTVQAINPAYEIMTGFQREELLRKPLVLFA
PGSHEREFVDAIWTTARQAGRWQGEVTSFRHSGDAFAAALSVTSVRAPNGVLEHYVLTIA
DISQRKSQEHQIRYQASFDRLTDLPNRWLVCERLEEAIVRAQRTKSKVAVAFLDLNRFKQ
VNDTLGHHAGDELLKLVARRLRNCTRMTDTVGRLGGDEFLIVAPDAADRSAGARLVEKVL
YSMSEPFSVHNQELFCGASIGIAFYPDDGETADQLLRNADLAMYHAKRNPEHKYVFYDSG
MRERSGFTLGLESDLRRASGGDEFELHFQPKIDLVGNRTIGAEALIRWRHPVRGVVSPAE
FIPLAEETGLIWEIGAWTLIESCRRLADWIRRDLPIPSVSVNLSPRQFQDARLVGFVRSV
VESAGIPADRLELELTEGAMIGDIEKAVTILNGLKDIGVRLSIDDFGTGYSSLAYLKRFP
IDTLKIDRSFVRDIVKSTTDPAIVGTIVNLAESLGFDTIAEGVETQEQADMLRQQRCTRI
QGYLISRPLPIDQFEAFLGNSVVPA