Protein Info for MPMX19_04569 in Azospirillum sp. SherDot2

Annotation: Anti-sigma-F factor NrsF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF06532: NrsF" amino acids 14 to 211 (198 residues), 176.5 bits, see alignment E=3.2e-56

Best Hits

KEGG orthology group: None (inferred from 52% identity to ara:Arad_4851)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>MPMX19_04569 Anti-sigma-F factor NrsF (Azospirillum sp. SherDot2)
MRTEDLIDRLALDPPPRFGFGTAFLTATLLSILVAGGVFLAVIGIRPDIGRAAESARFLF
KFVATMPLALGALGVALRLSRPGMAAGGWRLVLGAVPVLLAAAVALELHQVPATLWQSRL
VGANAGFCLSLIPLMAIGPLALLIGVMRRGAPERPALAGGFAGLAAGGIAATFYALHCPD
DSPLFVAAWYSAAILVMGVAGCLAGRRFLKW