Protein Info for MPMX19_04439 in Azospirillum sp. SherDot2

Annotation: Pca regulon regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02431: beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family
  • amino acids 25 to 269 (245 residues), 344 bits, E=2.1e-107
• PF09339: HTH_IclR
  • amino acids 30 to 80 (51 residues), 55.2 bits, 5e-19
• PF01614: IclR
  • amino acids 144 to 266 (123 residues), 118 bits, E=2.6e-38

Best Hits

Swiss-Prot: 55% identical to PCAR_PSEPU: Pca regulon regulatory protein (pcaR) from Pseudomonas putida

KEGG orthology group: K02624, IclR family transcriptional regulator, pca regulon regulatory protein (inferred from 95% identity to azl:AZL_a03500)

Predicted SEED Role

"Pca regulon regulatory protein PcaR" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Protein Sequence (277 amino acids)

>MPMX19_04439 Pca regulon regulatory protein (Azospirillum sp. SherDot2)
MAETQQLAGAADKTPSGAAEEASDPNFMTSLARGLSVIRAFTEREPNLTIADIAKITGLP
RAAARRCLLTLMQLGYAGSDGRTFHLKPKILALGYSFLSSAPLATILDPLIEQVSGAVQE
SCSAAVLDEDDVVYIARAATKRIMSVGLNVGSRLPAYCTSMGRVLLAALPEAELNAYLAR
VPLKPFTERTITAPDALKRELERVRDRGFSLVDQELELGLRSIAVPISTAAGGVVAAMNI
SAQAARVTCPEMEVQFLPHLHRASEEARVLLVRSRGV