Protein Info for MPMX19_04420 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details PF00892: EamA" amino acids 18 to 151 (134 residues), 82.1 bits, see alignment E=2.2e-27 amino acids 166 to 301 (136 residues), 63.6 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_a03670)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX19_04420 hypothetical protein (Azospirillum sp. SherDot2)
MPFPFLPSFLRSGPLAAYSLYIVGSALLASNPVVGRAAAHVVPPIGLAFWRWLIAFLIVL
PFALSGLLAHRGQLKAQWRRYLLLGVLGQGISGAIVYYGLERTSATNASLIYATSPAMIL
ALGAVWLGDAIRPRQILGILLAMAGVLVILTRGDLEALRHLSFNGGDLLVLTGAVSWSVY
TILLRQSGTPLPVVTAFAANALAGVLVLAPFYAWETVAVRPVPFSVSTVLSIVAVALFAS
VLALLAYQKTILMMGAARASTALYVSPLWAALASWAMLSEPLQGFHLMGVLLVLPGVMLA
TLQARKPAAEPAGKAA