Protein Info for MPMX19_04378 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 27 to 52 (26 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 288 (181 residues), 36.2 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 93% identity to azl:AZL_a04010)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>MPMX19_04378 hypothetical protein (Azospirillum sp. SherDot2)
MSTTLPDTAPAAPGGETPERRFSTAPLFLSGPAALLFAALVLTPLFLTALLSFNQFDYAT
GRTDGFTLEHYLAVVTDEYYLEIFLRTFRISALATAICVVIGVPEAYILSRMSNPWRSIF
LLVILAPLLVSVVVRAFGWSMLLGPEGPVNGALIALGIGRMKLLYSEGTVVVALVHVMLP
FMVIPVWTSLQKLDPAVEQAALSFGASRATAIVRVVAPQILPGILSGSLIVFGLSASAFA
IPGLLGGRRLKMVATVVYDQYLSDLNWPMGAAVAVILLAANLIIMLTYHRMVEGHYRRRL
G